DTX2 antibody

Catalog No. ABIN630801

Product Details anti-DTX2 Antibody

Target: DTX2 (Deltex Homolog 2 (DTX2))

Reactivity: Human, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DTX2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DTX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DTX2 Blocking Peptide, catalog no. 33R-2305, is also available for use as a blocking control in assays to test for specificity of this DTX2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DTX2

Target: DTX2 (Deltex Homolog 2 (DTX2))

Alternative Name: DTX2 (DTX2 Products)

Background: DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: Notch Signaling