TRIM45 antibody (N-Term)

Catalog No. ABIN630795

Product Details anti-TRIM45 Antibody

Target: TRIM45 (Tripartite Motif Containing 45 (TRIM45))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM45 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM45 antibody was raised against the N terminal of TRIM45

Purification: Affinity purified

Immunogen: TRIM45 antibody was raised using the N terminal of TRIM45 corresponding to a region with amino acids FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM45 Blocking Peptide, catalog no. 33R-2941, is also available for use as a blocking control in assays to test for specificity of this TRIM45 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM45

Target: TRIM45 (Tripartite Motif Containing 45 (TRIM45))

Alternative Name: TRIM45 (TRIM45 Products)

Synonyms: RNF99 antibody, 4921530N01Rik antibody, tripartite motif containing 45 antibody, tripartite motif-containing 45 antibody, TRIM45 antibody, trim45 antibody, Trim45 antibody

Background: TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described.

Molecular Weight: 64 kDa (MW of target protein)