HBXIP antibody (N-Term)

Catalog No. ABIN630790

Product Details anti-HBXIP Antibody

Target: HBXIP (Hepatitis B Virus X-Interacting Protein (HBXIP))

Binding Specificity: N-Term

Reactivity: Hepatitis B Virus (HBV)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HBXIP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HBXIP antibody was raised against the N terminal of HBXIP

Purification: Affinity purified

Immunogen: HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HBXIP Blocking Peptide, catalog no. 33R-2632, is also available for use as a blocking control in assays to test for specificity of this HBXIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBXIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HBXIP

Target: HBXIP (Hepatitis B Virus X-Interacting Protein (HBXIP))

Abstract: HBXIP Products

Synonyms: HBXIP antibody, xip antibody, XIP antibody, 1110003H18Rik antibody, Hbxip antibody, late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 antibody, Hepatitis B virus X-interacting protein antibody, LAMTOR5 antibody, xip antibody, Lamtor5 antibody

Target Type: Viral Protein

Background: HBXIP is a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.

Molecular Weight: 18 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, Regulation of Cell Size