SULT1C2 antibody (C-Term)
-
- Target See all SULT1C2 Antibodies
- SULT1C2 (Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SULT1C2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SULT1 C2 antibody was raised against the C terminal of SULT1 2
- Purification
- Affinity purified
- Immunogen
- SULT1 C2 antibody was raised using the C terminal of SULT1 2 corresponding to a region with amino acids LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
- Top Product
- Discover our top product SULT1C2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SULT1C2 Blocking Peptide, catalog no. 33R-4859, is also available for use as a blocking control in assays to test for specificity of this SULT1C2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT1C2 (Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2))
- Alternative Name
- SULT1C2 (SULT1C2 Products)
- Background
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1C2 is a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds.
- Molecular Weight
- 35 kDa (MW of target protein)
-