SULT1C2 antibody (C-Term)

Catalog No. ABIN630789

Product Details anti-SULT1C2 Antibody

Target: SULT1C2 (Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SULT1C2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SULT1 C2 antibody was raised against the C terminal of SULT1 2

Purification: Affinity purified

Immunogen: SULT1 C2 antibody was raised using the C terminal of SULT1 2 corresponding to a region with amino acids LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SULT1C2 Blocking Peptide, catalog no. 33R-4859, is also available for use as a blocking control in assays to test for specificity of this SULT1C2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SULT1C2

Target: SULT1C2 (Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2))

Alternative Name: SULT1C2 (SULT1C2 Products)

Synonyms: ST1C1 antibody, ST1C2 antibody, SULT1C1 antibody, humSULTC2 antibody, 1810008N17Rik antibody, Sult1c1 antibody, st1c1 antibody, st1c2 antibody, sult1c1 antibody, MGC88979 antibody, SULT1C2 antibody, Sult1c2 antibody, sulfotransferase family 1C member 2 antibody, sulfotransferase family, cytosolic, 1C, member 2 antibody, sulfotransferase family 1C member 2 S homeolog antibody, sulfotransferase 1C2 antibody, SULT1C2 antibody, Sult1c2 antibody, sult1c2 antibody, sult1c2.S antibody, LOC100060302 antibody, LOC100729651 antibody, LOC100623541 antibody

Background: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1C2 is a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds.

Molecular Weight: 35 kDa (MW of target protein)