Nephronectin antibody (Middle Region)
-
- Target See all Nephronectin (NPNT) Antibodies
- Nephronectin (NPNT)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Dog, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Nephronectin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Nephronectin antibody was raised against the middle region of NPNT
- Purification
- Affinity purified
- Immunogen
- Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE
- Top Product
- Discover our top product NPNT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Nephronectin Blocking Peptide, catalog no. 33R-9316, is also available for use as a blocking control in assays to test for specificity of this Nephronectin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPNT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nephronectin (NPNT)
- Alternative Name
- Nephronectin (NPNT Products)
- Background
- NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.
- Molecular Weight
- 62 kDa (MW of target protein)
-