Nephronectin antibody (Middle Region)

Catalog No. ABIN630784

Product Details anti-Nephronectin Antibody

Target: Nephronectin (NPNT)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nephronectin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Nephronectin antibody was raised against the middle region of NPNT

Purification: Affinity purified

Immunogen: Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Nephronectin Blocking Peptide, catalog no. 33R-9316, is also available for use as a blocking control in assays to test for specificity of this Nephronectin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPNT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nephronectin

Target: Nephronectin (NPNT)

Alternative Name: Nephronectin (NPNT Products)

Synonyms: POEM antibody, si:ch211-202n8.2 antibody, egfl6l antibody, 1110009H02Rik antibody, AA682063 antibody, AI314031 antibody, Nctn antibody, EGFL6L antibody, nephronectin antibody, NPNT antibody, npnt antibody, Npnt antibody

Background: NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.

Molecular Weight: 62 kDa (MW of target protein)