ALDOB antibody (Middle Region)

Catalog No. ABIN630782

Product Details anti-ALDOB Antibody

Target: ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDOB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALDOB antibody was raised against the middle region of ALDOB

Purification: Affinity purified

Immunogen: ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDOB Blocking Peptide, catalog no. 33R-4503, is also available for use as a blocking control in assays to test for specificity of this ALDOB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDOB

Target: ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))

Alternative Name: ALDOB (ALDOB Products)

Synonyms: aldb antibody, aldo2 antibody, xaldb antibody, ALDOB antibody, aldob antibody, ALDB antibody, ALDO2 antibody, Aldo-2 antibody, Aldo2 antibody, BC016435 antibody, LIV10 antibody, fb25f09 antibody, wu:fb25f09 antibody, aldolase B antibody, aldolase, fructose-bisphosphate B antibody, aldolase, fructose-bisphosphate B S homeolog antibody, aldolase b, fructose-bisphosphate antibody, aldolase B, fructose-bisphosphate antibody, xaldb antibody, aldob antibody, aldob.S antibody, ALDOB antibody, Aldob antibody

Background: Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.

Molecular Weight: 39 kDa (MW of target protein)