SPTAN1 antibody
-
- Target See all SPTAN1 Antibodies
- SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPTAN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SPTAN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
- Top Product
- Discover our top product SPTAN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPTAN1 Blocking Peptide, catalog no. 33R-5860, is also available for use as a blocking control in assays to test for specificity of this SPTAN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTAN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))
- Alternative Name
- SPTAN1 (SPTAN1 Products)
- Synonyms
- im:7157190 antibody, wu:fa20e05 antibody, wu:fb33g08 antibody, wu:fk32a10 antibody, zgc:112229 antibody, 2610027H02Rik antibody, Spna-2 antibody, Spna2 antibody, EIEE5 antibody, NEAS antibody, SPTA2 antibody, A2a antibody, IPF antibody, SPECA antibody, spectrin alpha, non-erythrocytic 1 antibody, spectrin, alpha, non-erythrocytic 1 antibody, SPTAN1 antibody, sptan1 antibody, Sptan1 antibody
- Background
- Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
- Molecular Weight
- 272 kDa (MW of target protein)
- Pathways
- Caspase Cascade in Apoptosis, Regulation of Actin Filament Polymerization
-