GLT6D1 antibody (Middle Region)
-
- Target See all GLT6D1 Antibodies
- GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLT6D1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GLT6 D1 antibody was raised against the middle region of GLT6 1
- Purification
- Affinity purified
- Immunogen
- GLT6 D1 antibody was raised using the middle region of GLT6 1 corresponding to a region with amino acids FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM
- Top Product
- Discover our top product GLT6D1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLT6D1 Blocking Peptide, catalog no. 33R-2916, is also available for use as a blocking control in assays to test for specificity of this GLT6D1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))
- Alternative Name
- GLT6D1 (GLT6D1 Products)
- Synonyms
- GLTDC1 antibody, GT6M7 antibody, GT6m7 antibody, Gltdc1 antibody, 4933411C14Rik antibody, QtsA-20904 antibody, glycosyltransferase 6 domain containing 1 antibody, GLT6D1 antibody, Glt6d1 antibody
- Background
- GLT6D1 is a single-pass type II membrane protein. It belongs to the glycosyltransferase 6 family. The exact function of GLT6D1 remains unknown.
- Molecular Weight
- 32 kDa (MW of target protein)
-