WWP2 antibody (Middle Region)

Catalog No. ABIN630775

Product Details anti-WWP2 Antibody

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WWP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WWP2 antibody was raised against the middle region of WWP2

Purification: Affinity purified

Immunogen: WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WWP2 Blocking Peptide, catalog no. 33R-8788, is also available for use as a blocking control in assays to test for specificity of this WWP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WWP2

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Alternative Name: WWP2 (WWP2 Products)

Synonyms: aip2 antibody, wwp2-like antibody, id:ibd1121 antibody, wu:fo87e10 antibody, zgc:154036 antibody, AIP2 antibody, WWp2-like antibody, 1300010O06Rik antibody, AA690238 antibody, AW554328 antibody, WW domain containing E3 ubiquitin protein ligase 2 antibody, WWP2 antibody, wwp2 antibody, Wwp2 antibody

Background: WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity