METAP1 antibody (N-Term)

Catalog No. ABIN630774

Product Details anti-METAP1 Antibody

Target: METAP1 (Methionyl Aminopeptidase 1 (METAP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: METAP1 antibody was raised against the N terminal of METAP1

Purification: Affinity purified

Immunogen: METAP1 antibody was raised using the N terminal of METAP1 corresponding to a region with amino acids GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METAP1 Blocking Peptide, catalog no. 33R-3198, is also available for use as a blocking control in assays to test for specificity of this METAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METAP1

Target: METAP1 (Methionyl Aminopeptidase 1 (METAP1))

Alternative Name: METAP1 (METAP1 Products)

Synonyms: MGC64362 antibody, METAP1 antibody, metap1 antibody, DKFZp468B1413 antibody, LOC100228334 antibody, DDBDRAFT_0205763 antibody, DDBDRAFT_0235405 antibody, DDB_0205763 antibody, DDB_0235405 antibody, MAP1A antibody, MetAP1A antibody, 1700029C17Rik antibody, AW047992 antibody, mKIAA0094 antibody, Metap1 antibody, im:7047238 antibody, wu:fc84e12 antibody, zgc:110093 antibody, methionyl aminopeptidase 1 S homeolog antibody, methionyl aminopeptidase 1 antibody, methionine aminopeptidase 1 antibody, methionyl aminopeptidase 1 L homeolog antibody, metap1.S antibody, METAP1 antibody, metap1 antibody, Metap1 antibody, metap1.L antibody

Background: METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling