Homeotic Protein Proboscipedia antibody (Middle Region)

Catalog No. ABIN630765

Product Details anti-Homeotic Protein Proboscipedia Antibody

Target: Homeotic Protein Proboscipedia (PB)

Binding Specificity: Middle Region

Reactivity: Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Homeotic Protein Proboscipedia antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PB antibody was raised against the middle region of Pb

Purification: Affinity purified

Immunogen: PB antibody was raised using the middle region of Pb corresponding to a region with amino acids DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PB Blocking Peptide, catalog no. 33R-2067, is also available for use as a blocking control in assays to test for specificity of this PB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Homeotic Protein Proboscipedia

Target: Homeotic Protein Proboscipedia (PB)

Alternative Name: PB (PB Products)

Background: Pb is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It controls development of mouthparts, and labial and maxillary palps.

Molecular Weight: 83 kDa (MW of target protein)