HOXA7 antibody (C-Term)
-
- Target See all HOXA7 Antibodies
- HOXA7 (Homeobox A7 (HOXA7))
-
Binding Specificity
- C-Term
-
Reactivity
- Drosophila melanogaster
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HOXA7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ANTP antibody was raised against the C terminal Of Antp
- Purification
- Affinity purified
- Immunogen
- ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
- Top Product
- Discover our top product HOXA7 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ANTP Blocking Peptide, catalog no. 33R-7700, is also available for use as a blocking control in assays to test for specificity of this ANTP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HOXA7 (Homeobox A7 (HOXA7))
- Alternative Name
- ANTP (HOXA7 Products)
- Synonyms
- ANTP antibody, HOX1 antibody, HOX1.1 antibody, HOX1A antibody, AV118143 antibody, Hox-1.1 antibody, HOXA-7 antibody, Hox-A7 antibody, antp antibody, hox36 antibody, HOXA7 antibody, Hox1r5 antibody, Hoxa7 antibody, hox1 antibody, hox1a antibody, hox1.1 antibody, Xhox-36 antibody, XlHbox-3 antibody, homeobox A7 antibody, homeobox A7 L homeolog antibody, HOXA7 antibody, Hoxa7 antibody, hoxa7.L antibody, hoxa7 antibody
- Background
- Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis.
- Molecular Weight
- 33 kDa (MW of target protein)
-