Chromosome 5 Open Reading Frame 39 (C5orf39) (N-Term) antibody

Catalog No. ABIN630761

Product Details

Target: Chromosome 5 Open Reading Frame 39 (C5orf39)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: C5 ORF39 antibody was raised against the N terminal Of C5 rf39

Purification: Affinity purified

Immunogen: C5 ORF39 antibody was raised using the N terminal Of C5 rf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C5ORF39 Blocking Peptide, catalog no. 33R-2665, is also available for use as a blocking control in assays to test for specificity of this C5ORF39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Chromosome 5 Open Reading Frame 39 (C5orf39)

Alternative Name: C5ORF39 (C5orf39 Products)

Synonyms: AX2R antibody, AXIIR antibody, C5orf39 antibody, annexin A2 receptor antibody, ANXA2R antibody

Background: C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.

Molecular Weight: 22 kDa (MW of target protein)