Myosin IC antibody (N-Term)

Catalog No. ABIN630755

Product Details anti-Myosin IC Antibody

Target: Myosin IC (MYO1C)

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Myosin IC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Myosin Ic antibody was raised against the N terminal of MYO1 C

Purification: Affinity purified

Immunogen: Myosin Ic antibody was raised using the N terminal of MYO1 C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Myosin Ic Blocking Peptide, catalog no. 33R-6834, is also available for use as a blocking control in assays to test for specificity of this Myosin Ic antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYO0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Myosin IC

Target: Myosin IC (MYO1C)

Alternative Name: Myosin Ic (MYO1C Products)

Background: This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus.

Molecular Weight: 113 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling