BLVRB antibody (Middle Region)
-
- Target See all BLVRB Antibodies
- BLVRB (Flavin Reductase (BLVRB))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BLVRB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BLVRB antibody was raised against the middle region of BLVRB
- Purification
- Affinity purified
- Immunogen
- BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD
- Top Product
- Discover our top product BLVRB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BLVRB Blocking Peptide, catalog no. 33R-3403, is also available for use as a blocking control in assays to test for specificity of this BLVRB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLVRB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BLVRB (Flavin Reductase (BLVRB))
- Alternative Name
- BLVRB (BLVRB Products)
- Synonyms
- BVRB antibody, FLR antibody, SDR43U1 antibody, biliverdin reductase B (flavin reductase (NADPH)) antibody, biliverdin reductase B antibody, Blvrb antibody, BLVRB antibody
- Background
- BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.
- Molecular Weight
- 22 kDa (MW of target protein)
-