NUP35 antibody (C-Term)

Catalog No. ABIN630746

Product Details anti-NUP35 Antibody

Target: NUP35 (Nucleoporin 35kDa (NUP35))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP35 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NUP35 antibody was raised against the C terminal of NUP35

Purification: Affinity purified

Immunogen: NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP35 Blocking Peptide, catalog no. 33R-8881, is also available for use as a blocking control in assays to test for specificity of this NUP35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP35

Target: NUP35 (Nucleoporin 35kDa (NUP35))

Alternative Name: NUP35 (NUP35 Products)

Synonyms: MGC64281 antibody, nup53 antibody, 2310006I24Rik antibody, 35kDa antibody, 5330402E05Rik antibody, MP44 antibody, NO44 antibody, fj68d11 antibody, wu:fj68d11 antibody, zgc:65979 antibody, NP44 antibody, NUP53 antibody, nucleoporin 35kDa L homeolog antibody, nucleoporin 35 antibody, nucleoporin 35kDa antibody, nucleoporin NUP53 antibody, nup35.L antibody, NUP35 antibody, nup35 antibody, CpipJ_CPIJ009421 antibody, Nup35 antibody

Background: NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC.

Molecular Weight: 35 kDa (MW of target protein)