METTL11B antibody (C-Term)

Catalog No. ABIN630741

Product Details anti-METTL11B Antibody

Target: METTL11B (C1ORF184) (Chromosome 10 Open Reading Frame 184 (C1ORF184))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL11B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF184 antibody was raised against the C terminal Of C1 rf184

Purification: Affinity purified

Immunogen: C1 ORF184 antibody was raised using the C terminal Of C1 rf184 corresponding to a region with amino acids NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF184 Blocking Peptide, catalog no. 33R-6909, is also available for use as a blocking control in assays to test for specificity of this C1ORF184 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF184 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL11B

Target: METTL11B (C1ORF184) (Chromosome 10 Open Reading Frame 184 (C1ORF184))

Alternative Name: C1ORF184 (C1ORF184 Products)

Synonyms: C1orf184 antibody, HOMT1B antibody, NTM1B antibody, Gm207 antibody, RGD1564106 antibody, methyltransferase like 11B antibody, METTL11B antibody, Mettl11b antibody, mettl11b antibody

Background: C1orf184 (Alpha-N-methyltransferase) methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala, Pro or Ser residue in the [Ala/Pro/Ser]-Pro-Lys motif.

Molecular Weight: 32 kDa (MW of target protein)