METTL11B antibody (C-Term)
-
- Target See all METTL11B (C1ORF184) Antibodies
- METTL11B (C1ORF184) (Chromosome 10 Open Reading Frame 184 (C1ORF184))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This METTL11B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 ORF184 antibody was raised against the C terminal Of C1 rf184
- Purification
- Affinity purified
- Immunogen
- C1 ORF184 antibody was raised using the C terminal Of C1 rf184 corresponding to a region with amino acids NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV
- Top Product
- Discover our top product C1ORF184 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1ORF184 Blocking Peptide, catalog no. 33R-6909, is also available for use as a blocking control in assays to test for specificity of this C1ORF184 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF184 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METTL11B (C1ORF184) (Chromosome 10 Open Reading Frame 184 (C1ORF184))
- Alternative Name
- C1ORF184 (C1ORF184 Products)
- Background
- C1orf184 (Alpha-N-methyltransferase) methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala, Pro or Ser residue in the [Ala/Pro/Ser]-Pro-Lys motif.
- Molecular Weight
- 32 kDa (MW of target protein)
-