ECHDC1 antibody (Middle Region)
-
- Target See all ECHDC1 Antibodies
- ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ECHDC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ECHDC1 antibody was raised against the middle region of ECHDC1
- Purification
- Affinity purified
- Immunogen
- ECHDC1 antibody was raised using the middle region of ECHDC1 corresponding to a region with amino acids GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG
- Top Product
- Discover our top product ECHDC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ECHDC1 Blocking Peptide, catalog no. 33R-3646, is also available for use as a blocking control in assays to test for specificity of this ECHDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))
- Alternative Name
- ECHDC1 (ECHDC1 Products)
- Synonyms
- MMCD antibody, dJ351K20.2 antibody, 1700028A24Rik antibody, AI314462 antibody, AI930038 antibody, D10Ertd667e antibody, MGC110060 antibody, zgc:110060 antibody, ethylmalonyl-CoA decarboxylase 1 antibody, ethylmalonyl-CoA decarboxylase 1 L homeolog antibody, enoyl Coenzyme A hydratase domain containing 1 antibody, enoyl CoA hydratase domain containing 1 antibody, echdc1 antibody, ECHDC1 antibody, echdc1.L antibody, Echdc1 antibody
- Background
- ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.
- Molecular Weight
- 33 kDa (MW of target protein)
-