NSUN2 antibody (C-Term)
-
- Target See all NSUN2 Antibodies
- NSUN2 (NOP2/Sun Domain Family, Member 2 (NSUN2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NSUN2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NSUN2 antibody was raised against the C terminal of NSUN2
- Purification
- Affinity purified
- Immunogen
- NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP
- Top Product
- Discover our top product NSUN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NSUN2 Blocking Peptide, catalog no. 33R-2934, is also available for use as a blocking control in assays to test for specificity of this NSUN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NSUN2 (NOP2/Sun Domain Family, Member 2 (NSUN2))
- Alternative Name
- NSUN2 (NSUN2 Products)
- Background
- Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 is a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA).
- Molecular Weight
- 86 kDa (MW of target protein)
-