NSUN2 antibody (C-Term)

Catalog No. ABIN630733

Product Details anti-NSUN2 Antibody

Target: NSUN2 (NOP2/Sun Domain Family, Member 2 (NSUN2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSUN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NSUN2 antibody was raised against the C terminal of NSUN2

Purification: Affinity purified

Immunogen: NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSUN2 Blocking Peptide, catalog no. 33R-2934, is also available for use as a blocking control in assays to test for specificity of this NSUN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSUN2

Target: NSUN2 (NOP2/Sun Domain Family, Member 2 (NSUN2))

Alternative Name: NSUN2 (NSUN2 Products)

Synonyms: D13Wsu123e antibody, Misu antibody, MISU antibody, MRT5 antibody, SAKI antibody, TRM4 antibody, RGD1311954 antibody, NOL1/NOP2/Sun domain family member 2 antibody, NOP2/Sun RNA methyltransferase family member 2 antibody, NOP2/Sun RNA methyltransferase family, member 2 antibody, NOP2/Sun RNA methyltransferase family member 2 S homeolog antibody, Nsun2 antibody, NSUN2 antibody, nsun2.S antibody

Background: Maturation of cytoplasmic tRNAs includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing tRNA genes. In tRNA-leu(CAA), the first position of the anticodon, C34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. NSUN2 is a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at C34 of tRNA-leu(CAA).

Molecular Weight: 86 kDa (MW of target protein)