GGPS1 antibody (Middle Region)
-
- Target See all GGPS1 Antibodies
- GGPS1 (Geranylgeranyl Diphosphate Synthase 1 (GGPS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GGPS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GGPS1 antibody was raised against the middle region of GGPS1
- Purification
- Affinity purified
- Immunogen
- GGPS1 antibody was raised using the middle region of GGPS1 corresponding to a region with amino acids LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ
- Top Product
- Discover our top product GGPS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GGPS1 Blocking Peptide, catalog no. 33R-4985, is also available for use as a blocking control in assays to test for specificity of this GGPS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGPS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GGPS1 (Geranylgeranyl Diphosphate Synthase 1 (GGPS1))
- Alternative Name
- GGPS1 (GGPS1 Products)
- Synonyms
- geranylgeranyl pyrophosphate synthase 1 antibody, DDBDRAFT_0192027 antibody, DDBDRAFT_0233098 antibody, DDB_0192027 antibody, DDB_0233098 antibody, GGPPS antibody, GGPPS1 antibody, 1810026C22Rik antibody, 9530089B04Rik antibody, AI843169 antibody, C79210 antibody, Crlf3 antibody, rGGPS1a antibody, rGGPS1a1 antibody, rGGPS1a2 antibody, rGGPS1a3 antibody, fb05f09 antibody, qm antibody, wu:fb05f09 antibody, zgc:101591 antibody, zgc:56514 antibody, geranylgeranyl pyrophosphate synthase 1 antibody, geranylgeranyl pyrophosphate synthetase antibody, geranyl pyrophosphate synthase antibody, geranylgeranyl pyrophosphate synthase,chloroplastic antibody, geranylgeranyl diphosphate synthase 1 antibody, geranylgeranyl diphosphate synthase 1 L homeolog antibody, GGPS1 antibody, gGPS1 antibody, ggps1 antibody, Ggps1 antibody, ggps1.L antibody
- Background
- GGPS1 is a member of the prenyltransferase family and has geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. The protein is an important precursor of carotenoids and geranylated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Molecular Weight
- 35 kDa (MW of target protein)
-