PARP6 antibody
-
- Target See all PARP6 products
- PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PARP6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PARP6 Blocking Peptide, catalog no. 33R-4528, is also available for use as a blocking control in assays to test for specificity of this PARP6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))
- Alternative Name
- PARP6 (PARP6 Products)
- Synonyms
- ARTD17 antibody, PARP-6-B1 antibody, PARP-6-C antibody, pART17 antibody, 1700119G14Rik antibody, 2310028P13Rik antibody, 3110038K10Rik antibody, C030013N01Rik antibody, PARP-6 antibody, RGD1310937 antibody, zgc:92798 antibody, poly(ADP-ribose) polymerase family member 6 antibody, poly (ADP-ribose) polymerase family, member 6 antibody, poly(ADP-ribose) polymerase family member 6 S homeolog antibody, poly [ADP-ribose] polymerase 6 antibody, poly (ADP-ribose) polymerase family, member 6a antibody, PARP6 antibody, Parp6 antibody, parp6 antibody, parp6.S antibody, LOC100475149 antibody, parp6a antibody
- Background
- Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
- Molecular Weight
- 59 kDa (MW of target protein)
-