GAPDH antibody (N-Term)
-
- Target See all GAPDH Antibodies
- GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GAPDH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GAPDH antibody was raised against the N terminal of GAPDH
- Purification
- Affinity purified
- Immunogen
- GAPDH antibody was raised using the N terminal of GAPDH corresponding to a region with amino acids IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW
- Top Product
- Discover our top product GAPDH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GAPDH Blocking Peptide, catalog no. 33R-3921, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." in: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).
: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." in: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).
: "
-
Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." in: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).
-
- Target
- GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
- Alternative Name
- GAPDH (GAPDH Products)
- Synonyms
- G3PD antibody, GAPD antibody, Gapd antibody, BEST:GH12586 antibody, CG12055 antibody, Dmel\\CG12055 antibody, GA3PDH antibody, GADPH antibody, GAP antibody, GAPDH antibody, GAPDH I antibody, GAPDH-1 antibody, GAPDH1 antibody, GAPDHI antibody, Gapdh antibody, Gapdh-1 antibody, Gapdh43E antibody, gadph antibody, gapdh antibody, gapdh-1 antibody, gh12586 antibody, cb609 antibody, gapd antibody, mg:bb02e05 antibody, wu:fb33a10 antibody, wu:ft80f05 antibody, KNC-NDS6 antibody, g3pd antibody, G3PDH antibody, glyceraldehyde-3-phosphate dehydrogenase antibody, Glyceraldehyde 3 phosphate dehydrogenase 1 antibody, glyceraldehyde-3-phosphate dehydrogenase S homeolog antibody, glyceraldehyde-3-phosphate dehydrogenase, type I antibody, olfactory receptor 8K3 antibody, GAPDH antibody, Gapdh antibody, Gapdh1 antibody, gapdh antibody, gapdh.S antibody, gapDH antibody, LOC100404960 antibody, LOC614985 antibody
- Background
- GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome.
- Molecular Weight
- 36 kDa (MW of target protein)
-