Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

GAPDH antibody (N-Term)

GAPDH Reactivity: Human, Dog WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN630723
  • Target See all GAPDH Antibodies
    GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
    Binding Specificity
    • 34
    • 22
    • 13
    • 10
    • 7
    • 6
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 212
    • 145
    • 138
    • 70
    • 64
    • 52
    • 36
    • 27
    • 22
    • 20
    • 19
    • 18
    • 17
    • 16
    • 11
    • 11
    • 11
    • 9
    • 9
    • 8
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Dog
    Host
    • 159
    • 94
    • 17
    • 11
    • 4
    Rabbit
    Clonality
    • 186
    • 97
    Polyclonal
    Conjugate
    • 153
    • 33
    • 18
    • 17
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This GAPDH antibody is un-conjugated
    Application
    • 228
    • 96
    • 71
    • 65
    • 43
    • 38
    • 30
    • 24
    • 16
    • 16
    • 15
    • 14
    • 7
    • 6
    • 5
    • 4
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    GAPDH antibody was raised against the N terminal of GAPDH
    Purification
    Affinity purified
    Immunogen
    GAPDH antibody was raised using the N terminal of GAPDH corresponding to a region with amino acids IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW
    Top Product
    Discover our top product GAPDH Primary Antibody
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    GAPDH Blocking Peptide, catalog no. 33R-3921, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Kuroda, Ishii, Uematsu, Ohata, Coban, Akira, Aritake, Urade, Morimoto: "Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." in: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).

    Shi, Zhang, Yang, Zhang, Wei: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." in: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).

  • Target
    GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
    Alternative Name
    GAPDH (GAPDH Products)
    Synonyms
    G3PD antibody, GAPD antibody, Gapd antibody, BEST:GH12586 antibody, CG12055 antibody, Dmel\\CG12055 antibody, GA3PDH antibody, GADPH antibody, GAP antibody, GAPDH antibody, GAPDH I antibody, GAPDH-1 antibody, GAPDH1 antibody, GAPDHI antibody, Gapdh antibody, Gapdh-1 antibody, Gapdh43E antibody, gadph antibody, gapdh antibody, gapdh-1 antibody, gh12586 antibody, cb609 antibody, gapd antibody, mg:bb02e05 antibody, wu:fb33a10 antibody, wu:ft80f05 antibody, KNC-NDS6 antibody, g3pd antibody, G3PDH antibody, glyceraldehyde-3-phosphate dehydrogenase antibody, Glyceraldehyde 3 phosphate dehydrogenase 1 antibody, glyceraldehyde-3-phosphate dehydrogenase S homeolog antibody, glyceraldehyde-3-phosphate dehydrogenase, type I antibody, olfactory receptor 8K3 antibody, GAPDH antibody, Gapdh antibody, Gapdh1 antibody, gapdh antibody, gapdh.S antibody, gapDH antibody, LOC100404960 antibody, LOC614985 antibody
    Background
    GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome.
    Molecular Weight
    36 kDa (MW of target protein)
You are here:
Support