CEP55 antibody (Middle Region)
-
- Target See all CEP55 Antibodies
- CEP55 (Centrosomal Protein 55kDa (CEP55))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CEP55 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CEP55 antibody was raised against the middle region of CEP55
- Purification
- Affinity purified
- Immunogen
- CEP55 antibody was raised using the middle region of CEP55 corresponding to a region with amino acids TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL
- Top Product
- Discover our top product CEP55 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CEP55 Blocking Peptide, catalog no. 33R-9162, is also available for use as a blocking control in assays to test for specificity of this CEP55 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEP55 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CEP55 (Centrosomal Protein 55kDa (CEP55))
- Alternative Name
- CEP55 (CEP55 Products)
- Synonyms
- C10orf3 antibody, CT111 antibody, URCC6 antibody, RGD1305340 antibody, 1200008O12Rik antibody, 2700032M20Rik antibody, centrosomal protein 55 antibody, CEP55 antibody, Cep55 antibody
- Background
- CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
- Molecular Weight
- 54 kDa (MW of target protein)
-