EEF1B2 antibody (Middle Region)
-
- Target See all EEF1B2 Antibodies
- EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EEF1B2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EEF1 B2 antibody was raised against the middle region of EEF1 2
- Purification
- Affinity purified
- Immunogen
- EEF1 B2 antibody was raised using the middle region of EEF1 2 corresponding to a region with amino acids VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE
- Top Product
- Discover our top product EEF1B2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EEF1B2 Blocking Peptide, catalog no. 33R-9624, is also available for use as a blocking control in assays to test for specificity of this EEF1B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))
- Alternative Name
- EEF1B2 (EEF1B2 Products)
- Synonyms
- EEF1B antibody, EEF1B1 antibody, EF1B antibody, 2810017J07Rik antibody, Eef1b antibody, fj06d02 antibody, wu:fj06d02 antibody, zgc:56277 antibody, zgc:86802 antibody, eef1b antibody, ef1b antibody, MGC89655 antibody, eukaryotic translation elongation factor 1 beta 2 antibody, eukaryotic translation elongation factor 1 beta 2 L homeolog antibody, EEF1B2 antibody, Eef1b2 antibody, eef1b2 antibody, eef1b2.L antibody
- Background
- EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.
- Molecular Weight
- 25 kDa (MW of target protein)
-