HERC4 antibody (N-Term)
-
- Target See all HERC4 Antibodies
- HERC4 (Hect Domain and RLD 4 (HERC4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HERC4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HERC4 antibody was raised against the n terminal of HERC4
- Purification
- Affinity purified
- Immunogen
- HERC4 antibody was raised using the N terminal of HERC4 corresponding to a region with amino acids MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL
- Top Product
- Discover our top product HERC4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HERC4 Blocking Peptide, catalog no. 33R-6183, is also available for use as a blocking control in assays to test for specificity of this HERC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HERC4 (Hect Domain and RLD 4 (HERC4))
- Alternative Name
- HERC4 (HERC4 Products)
- Background
- HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.
- Molecular Weight
- 13 kDa (MW of target protein)
-