HERC4 antibody (N-Term)

Catalog No. ABIN630701

Product Details anti-HERC4 Antibody

Target: HERC4 (Hect Domain and RLD 4 (HERC4))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HERC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HERC4 antibody was raised against the n terminal of HERC4

Purification: Affinity purified

Immunogen: HERC4 antibody was raised using the N terminal of HERC4 corresponding to a region with amino acids MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HERC4 Blocking Peptide, catalog no. 33R-6183, is also available for use as a blocking control in assays to test for specificity of this HERC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HERC4

Target: HERC4 (Hect Domain and RLD 4 (HERC4))

Alternative Name: HERC4 (HERC4 Products)

Synonyms: 1700056O17Rik antibody, 4921531D01Rik antibody, 9530080M15Rik antibody, mKIAA1593 antibody, HECT and RLD domain containing E3 ubiquitin protein ligase 4 antibody, HECT and RLD domain containing E3 ubiquitin protein ligase 4 S homeolog antibody, hect domain and RLD 4 antibody, HERC4 antibody, herc4 antibody, herc4.S antibody, Herc4 antibody

Background: HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.

Molecular Weight: 13 kDa (MW of target protein)