NUP155 antibody (Middle Region)

Catalog No. ABIN630700

Product Details anti-NUP155 Antibody

Target: NUP155 (Nucleoporin 155kDa (NUP155))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP155 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NUP155 antibody was raised against the middle region of NUP155

Purification: Affinity purified

Immunogen: NUP155 antibody was raised using the middle region of NUP155 corresponding to a region with amino acids ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP155 Blocking Peptide, catalog no. 33R-4155, is also available for use as a blocking control in assays to test for specificity of this NUP155 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP155 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP155

Target: NUP155 (Nucleoporin 155kDa (NUP155))

Alternative Name: NUP155 (NUP155 Products)

Background: Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.

Molecular Weight: 147 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus