RBBP7 antibody (N-Term)

Catalog No. ABIN630697

Product Details anti-RBBP7 Antibody

Target: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBBP7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBBP7 antibody was raised against the N terminal of RBBP7

Purification: Affinity purified

Immunogen: RBBP7 antibody was raised using the N terminal of RBBP7 corresponding to a region with amino acids MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBBP7 Blocking Peptide, catalog no. 33R-6545, is also available for use as a blocking control in assays to test for specificity of this RBBP7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBBP7

Target: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Alternative Name: RBBP7 (RBBP7 Products)

Background: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation.

Molecular Weight: 48 kDa (MW of target protein)