TUBA3C antibody (N-Term)

Catalog No. ABIN630696

Product Details anti-TUBA3C Antibody

Target: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, Arabidopsis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBA3C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Alpha Tubulin 3 C antibody was raised against the N terminal of TUBA3

Purification: Affinity purified

Immunogen: alpha Tubulin 3 C antibody was raised using the N terminal of TUBA3 corresponding to a region with amino acids QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

alpha Tubulin 3C Blocking Peptide, catalog no. 33R-7656, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 3C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBA3C

Target: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Abstract: TUBA3C Products

Synonyms: TUBA2 antibody, bA408E5.3 antibody, TUBA1A antibody, TUBA3 antibody, TUBA3C antibody, TUBA3D antibody, 3t antibody, ALPHA 84D antibody, CG2512 antibody, D.m.ALPHA-84D antibody, DTA4 antibody, Dmel\CG2512 antibody, T antibody, Tub antibody, Tub1A antibody, aTub84D antibody, alpha-Tub antibody, alpha-Tub84D antibody, alpha-tub antibody, alpha-tub84D antibody, alpha-tubulin antibody, alpha3 antibody, alpha3t antibody, alpha84D antibody, alphaTUB antibody, alphaTUB84D antibody, alphaTub antibody, alphaTub3 antibody, alphaTub84 antibody, tuba2 antibody, tuba3c antibody, tuba3d antibody, GRMZM2G153292 antibody, TUA2 antibody, zgc:73108 antibody, tubulin alpha 3c antibody, tubulin, alpha 3A antibody, tubulin alpha like 3 antibody, tubulin alpha-1B chain antibody, tubulin alpha-1A chain antibody, alpha-Tubulin at 84D antibody, tubulin alpha 3c S homeolog antibody, tubulin alpha-2 chain-like antibody, tubulin, alpha 2 antibody, TUBA3C antibody, Tuba3a antibody, TUBAL3 antibody, LOC610636 antibody, LOC782966 antibody, alphaTub84D antibody, tuba3c.S antibody, LOC103643947 antibody, tuba2 antibody

Background: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Microtubule Dynamics