GAPVD1 antibody (N-Term)

Catalog No. ABIN630695

Product Details anti-GAPVD1 Antibody

Target: GAPVD1 (GTPase Activating Protein and VPS9 Domains 1 (GAPVD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAPVD1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: GAPVD1 antibody was raised against the N terminal of GAPVD1

Purification: Affinity purified

Immunogen: GAPVD1 antibody was raised using the N terminal of GAPVD1 corresponding to a region with amino acids FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAPVD1 Blocking Peptide, catalog no. 33R-2950, is also available for use as a blocking control in assays to test for specificity of this GAPVD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPVD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GAPVD1

Target: GAPVD1 (GTPase Activating Protein and VPS9 Domains 1 (GAPVD1))

Alternative Name: GAPVD1 (GAPVD1 Products)

Synonyms: zgc:92666 antibody, GAPEX5 antibody, RAP6 antibody, 2010005B09Rik antibody, 4432404J10Rik antibody, AW108497 antibody, Gapex-5 antibody, RME-6 antibody, mKIAA1521 antibody, RGD1307479 antibody, GTPase activating protein and VPS9 domains 1 antibody, GTPase activating protein and VPS9 domains 1 S homeolog antibody, LOAG_00609 antibody, GAPVD1 antibody, gapvd1 antibody, gapvd1.S antibody, Gapvd1 antibody

Background: GAPVD1 acts both as a GTPase-activating protein (GAP) and a guanine nucleotide exchange factor (GEF), and participates in various processes such as endocytosis, insulin receptor internalization or LC2A4/GLUT4 trafficking. It acts as a GEF for the Ras-related protein RAB31 by exchanging bound GDP for free GTP, leading to regulate LC2A4/GLUT4 trafficking. In the absence of insulin, it maintains RAB31 in an active state and promotes a futile cycle between LC2A4/GLUT4 storage vesicles and early endosomes, retaining LC2A4/GLUT4 inside the cells. Upon insulin stimulation, it is translocated to the plasma membrane, releasing LC2A4/GLUT4 from intracellular storage vesicles. It is also involved in EGFR trafficking and degradation, possibly by promoting EGFR ubiquitination and subsequent degradation by the proteasome. It has GEF activity for Rab5 and GAP activity for Ras.

Molecular Weight: 166 kDa (MW of target protein)