H2AFY antibody (N-Term)

Catalog No. ABIN630688

Product Details anti-H2AFY Antibody

Target: H2AFY (H2A Histone Family, Member Y (H2AFY))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This H2AFY antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: H2 AFY antibody was raised against the N terminal of H2 FY

Purification: Affinity purified

Immunogen: H2 AFY antibody was raised using the N terminal of H2 FY corresponding to a region with amino acids HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

H2AFY Blocking Peptide, catalog no. 33R-3812, is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for H2AFY

Target: H2AFY (H2A Histone Family, Member Y (H2AFY))

Alternative Name: H2AFY (H2AFY Products)

Synonyms: H2A.y antibody, H2A/y antibody, H2AF12M antibody, H2AFJ antibody, MACROH2A1.1 antibody, mH2A1 antibody, macroH2A1.2 antibody, mH2a1 antibody, macroH2A1 antibody, wu:fa93c12 antibody, zgc:136891 antibody, h2a.y antibody, h2a/y antibody, h2af12m antibody, h2afj antibody, macroh2a antibody, mh2a1 antibody, core histone macro-H2A.1 antibody, H2A histone family, member Y antibody, H2A histone family member Y antibody, H2A histone family member Y L homeolog antibody, LOC100230612 antibody, H2AFY antibody, LOC481514 antibody, H2afy antibody, h2afy antibody, h2afy.L antibody

Background: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Molecular Weight: 39 kDa (MW of target protein)