RSF1 antibody (Middle Region)
-
- Target See all RSF1 Antibodies
- RSF1 (Remodeling and Spacing Factor 1 (RSF1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RSF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RSF1 antibody was raised against the middle region of RSF1
- Purification
- Affinity purified
- Immunogen
- RSF1 antibody was raised using the middle region of RSF1 corresponding to a region with amino acids QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK
- Top Product
- Discover our top product RSF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RSF1 Blocking Peptide, catalog no. 33R-7494, is also available for use as a blocking control in assays to test for specificity of this RSF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSF1 (Remodeling and Spacing Factor 1 (RSF1))
- Alternative Name
- RSF1 (RSF1 Products)
- Synonyms
- Rsf-1 antibody, CG5655 antibody, Dmel\\CG5655 antibody, ROX21 antibody, RSF1 antibody, Rox21 antibody, rox21 antibody, hbxap antibody, HBXAP antibody, RSF-1 antibody, XAP8 antibody, p325 antibody, 4832420A03Rik antibody, C030033M12Rik antibody, Gm164 antibody, Hbxap antibody, remodeling and spacing factor 1 antibody, Repressor splicing factor 1 antibody, remodeling and spacing factor 1 S homeolog antibody, RSF1 antibody, Rsf1 antibody, rsf1.S antibody
- Background
- RSF1 (HBXAP) is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.
- Molecular Weight
- 164 kDa (MW of target protein)
-