ING3 antibody (N-Term)

Catalog No. ABIN630670

Product Details anti-ING3 Antibody

Target: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ING3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ING3 antibody was raised against the N terminal of ING3

Purification: Affinity purified

Immunogen: ING3 antibody was raised using the N terminal of ING3 corresponding to a region with amino acids MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ING3 Blocking Peptide, catalog no. 33R-5862, is also available for use as a blocking control in assays to test for specificity of this ING3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ING3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ING3

Target: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Alternative Name: ING3 (ING3 Products)

Synonyms: ING3 antibody, Eaf4 antibody, ING2 antibody, MEAF4 antibody, p47ING3 antibody, 1300013A07Rik antibody, P47ING3 antibody, zgc:56327 antibody, inhibitor of growth family member 3 antibody, inhibitor of growth family, member 3 antibody, inhibitor of growth protein 3 antibody, inhibitor of growth family member 3 L homeolog antibody, ING3 antibody, Ing3 antibody, CpipJ_CPIJ009396 antibody, ing3 antibody, ing3.L antibody

Background: ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.

Molecular Weight: 47 kDa (MW of target protein)