SMUG1 antibody (Middle Region)
-
- Target See all SMUG1 Antibodies
- SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SMUG1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SMUG1 antibody was raised against the middle region of SMUG1
- Purification
- Affinity purified
- Immunogen
- SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC
- Top Product
- Discover our top product SMUG1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SMUG1 Blocking Peptide, catalog no. 33R-4200, is also available for use as a blocking control in assays to test for specificity of this SMUG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMUG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMUG1 (Single-Strand-Selective Monofunctional Uracil-DNA Glycosylase 1 (SMUG1))
- Alternative Name
- SMUG1 (SMUG1 Products)
- Synonyms
- SMUG1 antibody, xsmug1 antibody, 1200013B09Rik antibody, A930006H09Rik antibody, C85220 antibody, FDG antibody, HMUDG antibody, UNG3 antibody, single-strand-selective monofunctional uracil-DNA glycosylase 1 antibody, single-strand selective monofunctional uracil DNA glycosylase antibody, single-strand-selective monofunctional uracil-DNA glycosylase 1 L homeolog antibody, SMUG1 antibody, smug1 antibody, smuG1 antibody, smuG antibody, LOC5577584 antibody, CpipJ_CPIJ002767 antibody, Smug1 antibody, smug1.L antibody
- Background
- SMUG1 is a glycosylase that removes uracil from single- and double-stranded DNA in nuclear chromatin, thus contributing to base excision repair.
- Molecular Weight
- 30 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-