KPNA4 antibody

Catalog No. ABIN630664

Product Details anti-KPNA4 Antibody

Target: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KPNA4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Karyopherin Alpha 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Karyopherin Alpha 4 Blocking Peptide, catalog no. 33R-4568, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KPNA4

Target: KPNA4 (Karyopherin (Importin) alpha 4 (KPNA4))

Alternative Name: Karyopherin alpha 4 (KPNA4 Products)

Synonyms: IPOA3 antibody, QIP1 antibody, SRP3 antibody, 6 antibody, ATIMPALPHA3 antibody, IMPA-3 antibody, IMPORTIN ALPHA 3 antibody, IMPORTIN ALPHA ISOFORM 3 antibody, MODIFIER OF SNC1 antibody, T10M13.16 antibody, T10M13_16 antibody, LOC100224013 antibody, 1110058D08Rik antibody, importin antibody, ipoa3 antibody, qip1 antibody, srp3 antibody, impa3 antibody, wu:fa56d07 antibody, wu:fa66g10 antibody, wu:fe14c04 antibody, wu:fi04h11 antibody, wu:fi19b05 antibody, karyopherin subunit alpha 4 antibody, ARM repeat superfamily protein antibody, importin alpha 3 antibody, karyopherin (importin) alpha 4 antibody, karyopherin alpha 4 (importin alpha 3) S homeolog antibody, karyopherin alpha 4 (importin alpha 3) antibody, KPNA4 antibody, MOS6 antibody, LOC100533341 antibody, Kpna4 antibody, kpna4.S antibody, kpna4 antibody

Background: The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognise NLSs and dock NLS-containing proteins to the nuclear pore complex. KPNA4 shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus