TSSK2 antibody (Middle Region)
-
- Target See all TSSK2 Antibodies
- TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSSK2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TSSK2 antibody was raised against the middle region of TSSK2
- Purification
- Affinity purified
- Immunogen
- TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD
- Top Product
- Discover our top product TSSK2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TSSK2 Blocking Peptide, catalog no. 33R-8066, is also available for use as a blocking control in assays to test for specificity of this TSSK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSSK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))
- Alternative Name
- TSSK2 (TSSK2 Products)
- Synonyms
- DGS-G antibody, SPOGA2 antibody, STK22B antibody, TSK2 antibody, Stk22b antibody, Tsk2 antibody, TSSK2 antibody, testis specific serine kinase 2 antibody, testis-specific serine kinase 2 antibody, testis-specific serine/threonine-protein kinase 2 antibody, TSSK2 antibody, Tssk2 antibody, LOC486426 antibody, LOC100471688 antibody
- Background
- TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis.
- Molecular Weight
- 39 kDa (MW of target protein)
-