LPP antibody (N-Term)

Catalog No. ABIN630655

Product Details anti-LPP Antibody

Target: LPP (Lipoma-preferred partner (LPP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LPP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LPP antibody was raised against the N terminal of LPP

Purification: Affinity purified

Immunogen: LPP antibody was raised using the N terminal of LPP corresponding to a region with amino acids GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LPP Blocking Peptide, catalog no. 33R-3379, is also available for use as a blocking control in assays to test for specificity of this LPP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LPP

Target: LPP (Lipoma-preferred partner (LPP))

Alternative Name: LPP (LPP Products)

Synonyms: 9430020K16Rik antibody, AA959454 antibody, AU024130 antibody, B130055L10Rik antibody, C79715 antibody, D630048H16 antibody, LIM domain containing preferred translocation partner in lipoma antibody, LPP antibody, Lpp antibody

Background: LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.

Molecular Weight: 67 kDa (MW of target protein)