LPP antibody (N-Term)
-
- Target See all LPP Antibodies
- LPP (Lipoma-preferred partner (LPP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LPP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LPP antibody was raised against the N terminal of LPP
- Purification
- Affinity purified
- Immunogen
- LPP antibody was raised using the N terminal of LPP corresponding to a region with amino acids GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST
- Top Product
- Discover our top product LPP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LPP Blocking Peptide, catalog no. 33R-3379, is also available for use as a blocking control in assays to test for specificity of this LPP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LPP (Lipoma-preferred partner (LPP))
- Alternative Name
- LPP (LPP Products)
- Background
- LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.
- Molecular Weight
- 67 kDa (MW of target protein)
-