HIPK1 antibody (Middle Region)
-
- Target See all HIPK1 Antibodies
- HIPK1 (Homeodomain Interacting Protein Kinase 1 (HIPK1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HIPK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HIPK1 antibody was raised against the middle region of HIPK1
- Purification
- Affinity purified
- Immunogen
- HIPK1 antibody was raised using the middle region of HIPK1 corresponding to a region with amino acids PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
- Top Product
- Discover our top product HIPK1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HIPK1 Blocking Peptide, catalog no. 33R-7200, is also available for use as a blocking control in assays to test for specificity of this HIPK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HIPK1 (Homeodomain Interacting Protein Kinase 1 (HIPK1))
- Alternative Name
- HIPK1 (HIPK1 Products)
- Synonyms
- HIPK1 antibody, myak antibody, nbak2 antibody, hipk1 antibody, Myak antibody, Nbak2 antibody, 1110062K04Rik antibody, homeodomain interacting protein kinase 1 antibody, homeodomain interacting protein kinase 1 L homeolog antibody, homeodomain interacting protein kinase 1 S homeolog antibody, HIPK1 antibody, hipk1.L antibody, hipk1 antibody, hipk1.S antibody, Hipk1 antibody
- Background
- HIPK1 may play a role as a corepressor for homeodomain transcription factors. HIPK1 phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. HIPK1 may be involved in malignant squamous cell tumor formation.
- Molecular Weight
- 131 kDa (MW of target protein)
-