FRS3 antibody (Middle Region)
-
- Target See all FRS3 Antibodies
- FRS3 (Fibroblast Growth Factor Receptor Substrate 3 (FRS3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FRS3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FRS3 antibody was raised against the middle region of FRS3
- Purification
- Affinity purified
- Immunogen
- FRS3 antibody was raised using the middle region of FRS3 corresponding to a region with amino acids GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG
- Top Product
- Discover our top product FRS3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FRS3 Blocking Peptide, catalog no. 33R-3263, is also available for use as a blocking control in assays to test for specificity of this FRS3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FRS3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FRS3 (Fibroblast Growth Factor Receptor Substrate 3 (FRS3))
- Alternative Name
- FRS3 (FRS3 Products)
- Synonyms
- MGC82242 antibody, snt2 antibody, frs2b antibody, snt-2 antibody, frs2beta antibody, FRS2-beta antibody, FRS2B antibody, FRS2beta antibody, SNT-2 antibody, SNT2 antibody, 4930417B13Rik antibody, AI449674 antibody, Frs2beta antibody, Snt2 antibody, fibroblast growth factor receptor substrate 3 S homeolog antibody, fibroblast growth factor receptor substrate 3 antibody, frs3.S antibody, FRS3 antibody, frs3 antibody, Frs3 antibody
- Background
- FRS3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. FRS3 is involved in the activation of MAP kinases. FRS3 down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.
- Molecular Weight
- 54 kDa (MW of target protein)
-