KIF5A antibody (Middle Region)
-
- Target See all KIF5A Antibodies
- KIF5A (Kinesin Family Member 5A (KIF5A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF5A antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- KIF5 A antibody was raised against the middle region of KIF5
- Purification
- Affinity purified
- Immunogen
- KIF5 A antibody was raised using the middle region of KIF5 corresponding to a region with amino acids LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH
- Top Product
- Discover our top product KIF5A Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF5A Blocking Peptide, catalog no. 33R-4894, is also available for use as a blocking control in assays to test for specificity of this KIF5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF5A (Kinesin Family Member 5A (KIF5A))
- Alternative Name
- KIF5A (KIF5A Products)
- Synonyms
- KIF5A antibody, kif5a antibody, si:ch211-166e11.4 antibody, wu:fj61a10 antibody, nkhc antibody, my050 antibody, spg10 antibody, d12s1889 antibody, MGC122802 antibody, D12S1889 antibody, MY050 antibody, NKHC antibody, SPG10 antibody, D10Bwg0738e antibody, Khc antibody, Kif5 antibody, Kns antibody, mKIAA4086 antibody, kinesin family member 5A antibody, kinesin family member 5A, a antibody, KIF5A antibody, kif5aa antibody, kif5a antibody, Kif5a antibody
- Background
- KIF5A is a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.
- Molecular Weight
- 117 kDa (MW of target protein)
-