Raly antibody (N-Term)
-
- Target See all Raly (RALY) Antibodies
- Raly (RALY) (RNA-binding protein Raly (RALY))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Raly antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- RALY antibody was raised against the N terminal of RALY
- Purification
- Affinity purified
- Immunogen
- RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ
- Top Product
- Discover our top product RALY Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RALY Blocking Peptide, catalog no. 33R-6745, is also available for use as a blocking control in assays to test for specificity of this RALY antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Raly (RALY) (RNA-binding protein Raly (RALY))
- Alternative Name
- RALY (RALY Products)
- Background
- In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is due to anti-gly/ala antibodies that cross-react with host proteins containing configurations like those in the EBNA-1 repeat. One such antigen is RALY which is a member of the heterogeneous nuclear ribonucleoprotein gene family.
- Molecular Weight
- 30 kDa (MW of target protein)
-