Raly antibody (N-Term)

Catalog No. ABIN630644

Product Details anti-Raly Antibody

Target: Raly (RALY) (RNA-binding protein Raly (RALY))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Raly antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RALY antibody was raised against the N terminal of RALY

Purification: Affinity purified

Immunogen: RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RALY Blocking Peptide, catalog no. 33R-6745, is also available for use as a blocking control in assays to test for specificity of this RALY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Raly

Target: Raly (RALY) (RNA-binding protein Raly (RALY))

Alternative Name: RALY (RALY Products)

Synonyms: AI663842 antibody, Merc antibody, HNRPCL2 antibody, P542 antibody, zgc:103445 antibody, hnRNP-associated with lethal yellow antibody, RALY heterogeneous nuclear ribonucleoprotein antibody, Raly antibody, RALY antibody, raly antibody

Background: In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is due to anti-gly/ala antibodies that cross-react with host proteins containing configurations like those in the EBNA-1 repeat. One such antigen is RALY which is a member of the heterogeneous nuclear ribonucleoprotein gene family.

Molecular Weight: 30 kDa (MW of target protein)