KPNA6 antibody

Catalog No. ABIN630643

Product Details anti-KPNA6 Antibody

Target: KPNA6 (Karyopherin alpha 6 (Importin alpha 7) (KPNA6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KPNA6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Karyopherin Alpha 6 antibody was raised using a synthetic peptide corresponding to a region with amino acids STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Karyopherin Alpha 6 Blocking Peptide, catalog no. 33R-8891, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KPNA6

Target: KPNA6 (Karyopherin alpha 6 (Importin alpha 7) (KPNA6))

Alternative Name: Karyopherin alpha 6 (KPNA6 Products)

Synonyms: IPOA7 antibody, Kpna5 antibody, NPI-2 antibody, KPNA7 antibody, karyopherin subunit alpha 6 antibody, karyopherin (importin) alpha 6 antibody, karyopherin alpha 6 (importin alpha 7) antibody, karyopherin alpha 6 (importin alpha 7) S homeolog antibody, KPNA6 antibody, Kpna6 antibody, kpna6.S antibody

Background: The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. KPNA6 is a member of the importin alpha family.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus