TRIB2 antibody

Catalog No. ABIN630642

Product Details anti-TRIB2 Antibody

Target: TRIB2 (Tribbles Pseudokinase 2 (TRIB2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIB2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TRIB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIB2 Blocking Peptide, catalog no. 33R-10196, is also available for use as a blocking control in assays to test for specificity of this TRIB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIB2

Target: TRIB2 (Tribbles Pseudokinase 2 (TRIB2))

Alternative Name: TRIB2 (TRIB2 Products)

Synonyms: TRIB2 antibody, Trb2 antibody, Xtrbl antibody, gs3955 antibody, c5fw antibody, trb2 antibody, xtrb2 antibody, TRB2 antibody, C5FW antibody, GS3955 antibody, TRB-2 antibody, AW319517 antibody, RGD1564451 antibody, tribbles pseudokinase 2 antibody, tribbles pseudokinase 2 S homeolog antibody, TRIB2 antibody, trib2 antibody, trib2.S antibody, Trib2 antibody

Background: TRIB2 is one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia.

Molecular Weight: 39 kDa (MW of target protein)