CK1 epsilon antibody (N-Term)

Catalog No. ABIN630641

Product Details anti-CK1 epsilon Antibody

Target: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CK1 epsilon antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CK1 epsilon antibody was raised against the N terminal of CSNK1 E

Purification: Affinity purified

Immunogen: CK1 epsilon antibody was raised using the N terminal of CSNK1 E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CK1 epsilon Blocking Peptide, catalog no. 33R-5936, is also available for use as a blocking control in assays to test for specificity of this CK1 epsilon antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CK1 epsilon

Target: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Alternative Name: CK1 epsilon (CSNK1E Products)

Background: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Hedgehog Signaling, M Phase