STRAP antibody (N-Term)

Catalog No. ABIN630640

Product Details anti-STRAP Antibody

Target: STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STRAP antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: STRAP antibody was raised against the N terminal of STRAP

Purification: Affinity purified

Immunogen: STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STRAP Blocking Peptide, catalog no. 33R-3756, is also available for use as a blocking control in assays to test for specificity of this STRAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STRAP

Target: STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))

Alternative Name: STRAP (STRAP Products)

Synonyms: MAWD antibody, PT-WD antibody, UNRIP antibody, zgc:56677 antibody, zgc:77604 antibody, mawd antibody, pt-wd antibody, unrip antibody, AW557906 antibody, C78091 antibody, C79202 antibody, Unrip antibody, serine/threonine kinase receptor associated protein antibody, tetratricopeptide repeat domain 5 antibody, serine/threonine kinase receptor associated protein L homeolog antibody, serine/threonine kinase receptor associated protein S homeolog antibody, STRAP antibody, TTC5 antibody, strap antibody, strap.L antibody, strap.S antibody, Strap antibody

Background: The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.

Molecular Weight: 38 kDa (MW of target protein)