SMC2 antibody (N-Term)

Catalog No. ABIN630626

Product Details anti-SMC2 Antibody

Target: SMC2 (Structural Maintenance of Chromosomes 2 (SMC2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SMC2 antibody was raised against the N terminal of SMC2

Purification: Affinity purified

Immunogen: SMC2 antibody was raised using the N terminal of SMC2 corresponding to a region with amino acids ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMC2 Blocking Peptide, catalog no. 33R-4161, is also available for use as a blocking control in assays to test for specificity of this SMC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMC2

Target: SMC2 (Structural Maintenance of Chromosomes 2 (SMC2))

Alternative Name: SMC2 (SMC2 Products)

Synonyms: CAP-E antibody, CAPE antibody, SMC-2 antibody, SMC2L1 antibody, 5730502P04Rik antibody, AI255214 antibody, AW545314 antibody, Fin16 antibody, Smc2l1 antibody, fb92e05 antibody, wu:fb92e05 antibody, zeh1628 antibody, zgc:55326 antibody, xcap-e antibody, SCII antibody, structural maintenance of chromosomes 2 antibody, structural maintenance of chromosomes 2 L homeolog antibody, SMC2 antibody, Smc2 antibody, smc2 antibody, smc2.L antibody

Background: SMC2 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Molecular Weight: 32 kDa (MW of target protein)