PIP5KL1 antibody (Middle Region)
-
- Target See all PIP5KL1 Antibodies
- PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIP5KL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIP5 KL1 antibody was raised against the middle region of PIP5 L1
- Purification
- Affinity purified
- Immunogen
- PIP5 KL1 antibody was raised using the middle region of PIP5 L1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP
- Top Product
- Discover our top product PIP5KL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIP5KL1 Blocking Peptide, catalog no. 33R-9646, is also available for use as a blocking control in assays to test for specificity of this PIP5KL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 L1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))
- Alternative Name
- PIP5KL1 (PIP5KL1 Products)
- Synonyms
- PIPKH antibody, bA203J24.5 antibody, BC028795 antibody, phosphatidylinositol-4-phosphate 5-kinase like 1 antibody, phosphatidylinositol-4-phosphate 5-kinase-like 1 antibody, PIP5KL1 antibody, Pip5kl1 antibody
- Background
- PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-