PPP2R5C antibody (Middle Region)
-
- Target See all PPP2R5C Antibodies
- PPP2R5C (Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2R5C))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP2R5C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PPP2 R2 antibody was raised against the middle region of PPP2 2
- Purification
- Affinity purified
- Immunogen
- PPP2 R2 antibody was raised using the middle region of PPP2 2 corresponding to a region with amino acids RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK
- Top Product
- Discover our top product PPP2R5C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP2R5C Blocking Peptide, catalog no. 33R-7903, is also available for use as a blocking control in assays to test for specificity of this PPP2R5C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP2R5C (Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2R5C))
- Alternative Name
- PPP2R5C (PPP2R5C Products)
- Synonyms
- B56G antibody, PR61G antibody, 2610043M05Rik antibody, 2700063L20Rik antibody, AI060890 antibody, AW545884 antibody, C85228 antibody, D12Bwg0916e antibody, mKIAA0044 antibody, b56g antibody, ppp2r5c antibody, si:dkey-241l7.9 antibody, protein phosphatase 2 regulatory subunit B'gamma antibody, protein phosphatase 2, regulatory subunit B', gamma antibody, protein phosphatase 2 regulatory subunit B', gamma antibody, protein phosphatase 2, regulatory subunit B', gamma b antibody, protein phosphatase 2, regulatory subunit B', gamma a antibody, PPP2R5C antibody, Ppp2r5c antibody, ppp2r5c antibody, ppp2r5c.L antibody, ppp2r5cb antibody, ppp2r5ca antibody
- Background
- The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signaling
-