CMAS antibody (N-Term)

Catalog No. ABIN630605

Product Details anti-CMAS Antibody

Target: CMAS (Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CMAS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CMAS antibody was raised against the N terminal of CMAS

Purification: Affinity purified

Immunogen: CMAS antibody was raised using the N terminal of CMAS corresponding to a region with amino acids GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CMAS Blocking Peptide, catalog no. 33R-3531, is also available for use as a blocking control in assays to test for specificity of this CMAS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CMAS

Target: CMAS (Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS))

Alternative Name: CMAS (CMAS Products)

Synonyms: CSS antibody, cmas antibody, cmas1 antibody, si:dkey-183c2.1 antibody, wu:fj16c12 antibody, zgc:136241 antibody, AW208911 antibody, CMPNeu5Ac antibody, D6Bwg0250e antibody, cytidine monophosphate N-acetylneuraminic acid synthetase antibody, cytidine monophosphate N-acetylneuraminic acid synthetase a antibody, cytidine monophospho-N-acetylneuraminic acid synthetase antibody, CMAS antibody, Cmas antibody, cmasa antibody, cmas antibody

Background: CMAS is an enzyme that catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.

Molecular Weight: 48 kDa (MW of target protein)