HPRT1 antibody

Catalog No. ABIN630595

Product Details anti-HPRT1 Antibody

Target: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HPRT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HPRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HPRT1 Blocking Peptide, catalog no. 33R-8866, is also available for use as a blocking control in assays to test for specificity of this HPRT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPRT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HPRT1

Target: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Alternative Name: HPRT1 (HPRT1 Products)

Synonyms: HGPRT antibody, HPRT antibody, C81579 antibody, HPGRT antibody, Hprt1 antibody, Hgprtase antibody, Hprt antibody, id:ibd1344 antibody, id:ibd5108 antibody, wu:fc10g09 antibody, zgc:56221 antibody, zgc:86608 antibody, hgprt antibody, hprt antibody, prtfdc1 antibody, hprt1 antibody, hprt1l antibody, zgc:55561 antibody, zgc:86771 antibody, hypoxanthine phosphoribosyltransferase 1 antibody, hypoxanthine guanine phosphoribosyl transferase antibody, hypoxanthine phosphoribosyltransferase 1 L homeolog antibody, phosphoribosyl transferase domain containing 1 antibody, HPRT1 antibody, Hprt antibody, Hprt1 antibody, hprt1 antibody, hprt1.L antibody, prtfdc1 antibody

Background: HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process